Skip to content

Latest commit

 

History

History
300 lines (231 loc) · 9.85 KB

File metadata and controls

300 lines (231 loc) · 9.85 KB

Working with Sequence Features

This picks up from the end of the section on reading sequence files, but looks at the feature annotation included in some file formats like EMBL or GenBank.

Most of the time GenBank files contain a single record for a single chromosome or plasmid, so we'll generally use the SeqIO.read(...) function. Remember the second argument is the file format, so if we start from the code to read in a FASTA file:

>>> from Bio import SeqIO
>>> record = SeqIO.read("NC_000913.fna", "fasta")
>>> print(record.id)
gi|556503834|ref|NC_000913.3|
>>> print(len(record))
4641652
>>> print(len(record.features))
0

Now switch the filename and the format:

>>> from Bio import SeqIO
>>> record = SeqIO.read("NC_000913.gbk", "genbank")
>>> print(record.id)
NC_000913.3
>>> print(len(record))
4641652
>>> print(len(record.features))
23086

So what is this new .features thing? It is a Python list, containing a Biopython SeqFeature object for each feature in the GenBank file. For instance,

>>> my_gene = record.features[3]
>>> print(my_gene)
type: gene
location: [336:2799](+)
qualifiers:
    Key: db_xref, Value: ['EcoGene:EG10998', 'GeneID:945803']
    Key: gene, Value: ['thrA']
    Key: gene_synonym, Value: ['ECK0002; Hs; JW0001; thrA1; thrA2; thrD']
    Key: locus_tag, Value: ['b0002']

Doing a print like this tries to give a human readable display. There are three key properties, .type which is a string like gene or CDS, .location which describes where on the genome this feature is, and .qualifiers which is a Python dictionary full of all the annotation for the feature (things like gene identifiers).

This is what this gene looks like in the raw GenBank file:

gene            337..2799
                /gene="thrA"
                /locus_tag="b0002"
                /gene_synonym="ECK0002; Hs; JW0001; thrA1; thrA2; thrD"
                /db_xref="EcoGene:EG10998"
                /db_xref="GeneID:945803"

Hopefully it is fairly clear how this maps to the SeqFeature structure. The Biopython Tutorial & Cookbook (PDF) goes into more detail about this.

Feature Locations

We're going to focus on using the location information for different feature types. Continuing with the same example:

>>> from Bio import SeqIO
>>> record = SeqIO.read("NC_000913.gbk", "genbank")
>>> my_gene = record.features[3]
>>> print(my_gene.qualifiers["locus_tag"])
['b0002']
>>> print(my_gene.location)
[336:2799](+)
>>> print(my_gene.location.start)
336
>>> print(my_gene.location.end)
2799
>>> print(my_gene.location.strand)
1

Recall in the GenBank file this simple location was 337..2799, yet in Biopython this has become a start value of 336 and 2799 as the end. The reason for this is to match how Python counting works, in particular how Python string slicing. In order to pull out this sequence from the full genome we need to use slice values of 336 and 2799:

>>> gene_seq = record.seq[336:2799]
>>> len(gene_seq)
2463
>>> print(gene_seq)
...

This was a very simple location on the forward strand, if it had been on the reverse strand you'd need to take the reverse-complement. Also if the location had been a more complicated compound location like a join (used for eukaryotic genes where the CDS is made up of several exons), then the location would have-sub parts to consider.

All these complications are taken care of for you via the .extract(...) method which takes the full length parent record's sequence as an argument:

>>> gene_seq = my_gene.extract(record.seq)
>>> len(gene_seq)
2463
>>> print(gene_seq)
...

Exercise: Finish the following script by setting an appropriate feature name like the locus tag or GI number (use the .qualifiers or .dbxrefs information) to extract all the coding sequences from the GenBank file:

from Bio import SeqIO
record = SeqIO.read("NC_000913.gbk", "genbank")
output_handle = open("NC_000913_cds.fasta", "w")
count = 0
for feature in record.features:
    if feature.type == "CDS":
        count = count + 1
        feature_name = "..." # Use feature.qualifiers or feature.dbxrefs here
        feature_seq = feature.extract(record.seq)
        # Simple FASTA output without line wrapping:
        output_handle.write(">" + feature_name + "\n" + str(feature_seq) + "\n")
output_handle.close()
print(str(count) + " CDS sequences extracted")
$ python extract_cds.py
4321 CDS sequences extracted

Check your sequences using the NCBI provided FASTA file NC_000913.ffn.

Advanced exercise: Can you recreate the NCBI naming scheme as used in NC_000913.ffn?

Advanced exercise: Using the Biopython documentation, can you create a new SeqRecord object and then use SeqIO.write(...) which will produce line-wrapped FASTA output.

Feature Lengths

The length of Biopython's SeqFeature objects (and the location objects) is defined as the length of the sequence region they describe (i.e. how many bases are includied; or for protein annotation how many amino acids).

>>> len(my_gene)
2463

Remember when we checked the length of my_gene.extract(record.seq) that also gave 2463.

This example loops over all the features looking for gene records, and calculates their total length:

from Bio import SeqIO
record = SeqIO.read("NC_000913.gbk", "genbank")
total = 0
for feature in record.features:
    if feature.type == "gene":
        total = total + len(feature)
print("Total length of all genes is " + str(total))
$ python total_gene_lengths.py
Total length of genome is 4641652
Total length of all genes is 4137243

Exercise: Give a separate count for each feature type. Use a dictionary where the keys are the feature type (e.g. "gene" and "CDS") and the values are the count for that type.

Discussion: What proportion of the genome is annotated as gene coding? What assumptions does this estimate 89% make:

>>> 4137243 * 100.0 / 4641652
89.13298541122859

Exercise: Extend the previous script to also count the number of features of each type, and report this and the average length of that feature type. e.g.

$ python total_feature_lengths.py
Total length of genome is 4641652
misc_feature
 - total number: 13686
 - total length: 6136082
 - average length: 448.347362268
mobile_element
 - total number: 49
 - total length: 50131
 - average length: 1023.08163265
...

Discussion: What proportion of the genome is annotated with misc_feature? Does this simple calculation give a meaningful answer?

>>> 6136082 * 100.0 / 4641652
132.19608018869144

This is an alternative approach, using some more advanced bits of Python like the set datatype, and the concept of iterating over the bases within a feature:

>>> from Bio import SeqIO
>>> record = SeqIO.read("NC_000913.gbk", "genbank")
>>> bases = set()
>>> for feature in record.features:
...     if feature.type == "misc_feature":
...         bases.update(feature.location)
...
>>> print(len(bases) * 100.0 / len(record))
80.69355479471533

Exercise: Without worrying to much about how it works, modify this example to count the number of bases in the gene features.

$ python bases_in_genes.py
88.9494085295

Discussion: Compare this calculation (88.95%) to one earlier (89.13%). Which is a better estimate of the proportion of the genome which encodes genes? When might these methods give very different answers? Any virologists in the group? How should this be defined given that any single base may be in more than one gene?

Translating CDS features

When dealing with GenBank files and trying to get the protein sequence of the genes, you'll need to look at the CDS features (coding sequences) - not the gene features (although for simple cases they'll have the same location).

Sometimes, as in the E. coli exmaple, you will find the translation is provided in the qualifiers:

>>> from Bio import SeqIO
>>> record = SeqIO.read("NC_000913.gbk", "genbank")
>>> my_cds = record.features[4]
>>> print(my_cds.qualifiers["locus_tag"])
['b0002']
>>> print(my_cds.qualifiers["translation"])
['MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDALPNI...KLGV']

This has been truncated for display here - the whole protein sequence is present. However, many times the annotation will not include the amino acid translation - but we can get it by translating the nucleotide sequence.

>>> print(cds_seq.translate(table=11))
>>> protein_seq = cds_seq.translate(table=11)
>>> len(protein_seq)
821
>>> print(protein_seq)
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDALPNI...KLGV*

Notice because this is a bacteria, we used the NCBI translation table 11, rather than the default (suitable for humans etc).

Advanced Exercise: Using this information, and the CDS extraction script from earlier, translate all the CDS features into a FASTA file.

Check your sequences using the NCBI provided FASTA file NC_000913.faa.